GenomeNet

>btt:HD73_4284 no KO assigned | (GenBank) hypothetical protein (A)
MKIWGRISDTGKYSIPLQPVLWIDGSKKENEFPQVAVTLQIGSMYTEQFSYELTYDVNDI
LIMRIEVENKGVEMISRVVVSHMIRDYFAYIPNSLKVDKGISEFLFQLVRWRIDDLLPNE
KVELRCKIKANKDKALKQTFFQATYTFQDKEISYGPLQTNEVVVRQ

BLAST