GenomeNet

>buk:MYA_4071 K11905 type VI secretion system protein | (GenBank) hypothetical protein (A)
MWTGPGLFERITRHFADGSAVDDFAAEVQVFLSVRDNIERILNSRRGSLAHLPDYGLDDL
SAIYRHLPSSAHKLQRAIEATLLAYEPRLKKVEIEIHPPEPGMLISFTMACHLHREGLVR
FGTNFMPDGKTRLRMLQAALDRY

BLAST