GenomeNet

>buk:MYA_4722 K11893 type VI secretion system protein ImpJ | (GenBank) type VI secretion protein ImpJ/VasE (A)
MNAFRRAPLHRYFHSRTTNKMKITRPLWAKGIFMTPQHFQQQAIWEQYVHDRVARIASPD
AWGAVHVALDSEALSVNRLQCTALGLRLPDGTLIDSETADWLPAARSLDDVPTTVDSVTV
LAGVALMDAQGGNCVEPGEKPARPRRVTREYKHVADLNGDGQEEITVERNVVALLFDFEQ
AGDYVTCPIARLVRTPQGRFEQDKSFVPPCLFLSASDRLVHRAQRISEILSAKSASLAVR
RKERSDQIADFAVSDVALFWLLHSVNSTWPELARLVQAPDQHPERLYAVLARLAGSLLTF
STTESLQAIPLYDHHAPEPMFAELESLIRTLLDAVIPSRVVPIALERVRATTWLGRINDE
RLTEGAEYYLSVQAAMPAHALIEHLPRLCKVGAPDEVEQIVNSALLGIALRPMSRLPAAI
PVRIENQYFALDSNDAAFKRMIDAHACQIYVPASIPEASLELYAVLPS

BLAST