GenomeNet

>bvg:104902608 K17498 transcription factor SPN1 | (RefSeq) protein IWS1 homolog 1 (A)
MAFDDPYRDEDGEPLMDYDDIQSDDDQVQLPPNDDVQDFNDVDDDDEEGGGNGNWNQEPK
AKTRKRLIKKSDDHSSMPPEFNDFADEDDVGEPEYGSFPEEEEEEEPSPSISKKRKDKGM
MKEGGEKRRKEKKLRKDKYSSSAGGSDGGKGKLSLRRKKGNDEGDPEMKEMWDTIAGGDS
EDDQEGMKTLDDDNFIDDTGVDPADMYNDREAASPSRFDQAEEGEEDDEMRDLFKGGKKK
KKNEKSAAEIAELVETLMAELEVVAEEDAVLNTQGKPAINKLRKLPLLTQALSKKQLQHE
FLDHGVLTLLKNWLEPLPDGSLPNINIREAILRILTDFPIDLDQYDRREQLKKSGLGKVI
MFLSRSDEETTSNRKLAKDLVDKWSRPIFNKSTRFEDMRNVEEERVYRRPPVKKPANKSS
GLESKDDDLEFSSGRKAGPSASRQHASRPEATPMDFLIRPQSKIDPDEIRARAKQQQQDE
RRMKMNKKMQQLKQMKKKKLQATSVSVEGRGMVKYL

BLAST