GenomeNet

>byi:BYI23_C003640 K11896 type VI secretion system protein ImpG | (GenBank) type VI secretion protein (A)
MNPDLIQYYSRELQHIREMGGEFAQAFPKIAGRLGLEGFECADPYVERLLEGFGFLAARV
QMKIDAEFPRFTQHLAELVYPHYLAPTPAMTVVHVQPDMTHPALAEGVPVPRGTALHGRL
DGERATRCEFRTAHGLTLWPIELSAARLFTHTGAMPGIEARLPRGVKAGLRLTLRASGGR
KLRDLAIDRLPMYLRGNDGVAAKLYELLVGSTLGVVAGDAVLPASALRPLGFSDEEALLP
VSEQSFPGYRLLQEYFACPQRFMFIGIEGLRAQLARCDKSEIELVVLLSRADTALEQVVD
QANFALHCTPAINLFPRRADRIAVTGEQFEHHVVVDRTRPRDFEVVRIQGVTGYRAGGGE
IAFQPFYRMRDLGIDEPDAAFYQVRREKRLPSARENERGVRSAARSSYAGSETWIALVDT
RESPYPADLHQLGISVLCTNRDLTLTMPLGRGETDFTLELEAPVAAVRCVAAPSRPLPSY
AQGAVAWRLLSHLSLNHGSLVDDADGSGARAMRDLLALYAPEGDSAAARQIDALRSIRSN
AVTRRLPSRGPIVFGRGLALDVLLDESGFEGASAFLFGAVLARFFEQYVSLNAFTETIVS
SVTRGEIMRWAPESGRCRTL

BLAST