GenomeNet

>cacn:RN83_05420 K03553 recombination protein RecA | (GenBank) recombinase RecA (A)
MAATADREKALATALQQIEKQHGKGSIMRLGEQETVKIAAIPTGSVALDVALGVGGLPRG
RIVEIYGPESSGKTTVALHAIANAQAEGGICAFIDAEHALDPEYARKLGVDTDSLLVSQP
DNGEQALEIADTLVRSGALELVVVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKMT
GALNAAGTTAIFINQLREKIGVMFGSPETTTGGRALKFYSSVRLDVRRVETLKDGSEMVG
NRTRVKVAKNKVAPPFKQAEFDILYGQGISREGSLIDMGVDCGIITKSGSWFSYNNEQLG
QGKENVRKFLKGNPDVANEIEDKILTHLGLREAEVPEGVDPRTGEVEF

BLAST