GenomeNet

>cacn:RN83_06950 K03583 exodeoxyribonuclease V gamma subunit [EC:3.1.11.5] | (GenBank) exodeoxyribonuclease V subunit gamma (A)
MAGVVKVVHSWRCVSDAVVAALSEPTTDPFVRPILVAPGNAQSRSLLQSLARRHGIAAGI
DTTTPLGLRERLEEDLLGIKRENDPWQPGPLALRICRIIENNPPGFEVVSAHLEASRRQG
VPRATWTTARQAADAICALARDSHDVLNAWAAGAAPTSHKGDTDLAGDPLDPARAWWAPL
WRTLLAEPCHVPDPVSRHQLLVDAILTQSRSEPPIVWFSSTTTAQHDVSFAEALSASHDV
TIVHLDHGIGGANPWRTFDRARSATTARWTSSSIRTAQSAVTHRKELPTVEIHQCHGVDR
QAEVVRDVVCAALADYPTLEPRDIVVICCGRQDTAHLLSAGTLADINHPAHQLRFTTPPQ
REHVNPVTEAVTTILGLASSRATGQDLLSLCAMPAVRTRFGFSDDDQEAIERLVSQADIR
WGVDPAARNKAGLGRIRQSTWLAGIERMILAIAMSSTPPTYLGTVTPITDVGSTTIPLVG
KLAELVSRMRKAFLDTETPAPIATWKRRVRQIVDNLTAAPADAPRSALQTLALLTGLEGV
AEDREFNRQEIIDLLNWLSGIHRGRHSWFDGSIQVCRPGELTPVDHEVVIVVDPDQETVH
ADLLQGLRDENLDPTAKARQDLLDVALSARTLLVVVRQARSPVSNLTVLRGPFTRTLSQA
LKAQSATPRCVKHGLQPFSADEFSHHSNTAWSGFDNAAAAAAGCHPGSQPRPHRVVLPPV
AKLPESRMSLTDLTLALSHPARTLLRARAGAPANERSTDLPVDLPLAPSSLDKYWIRSRI
LADLEHGSLPDDAINAERLRGSTPPGHLGQRIVTKLAEDAMQIYQRANQLRGDQDEQFIE
IDIDLDEGDSPPLLWPDELIVDPMHPVHLRGRVGVRNHHIVHAVASRANARPLLDLWVDL
LAVTVATDEPGWFGVLVPNGNVLRMASPAPDHARDILAGLARVAWWSNQQLIPLPVKLAH
ALVELSPMAHNDYRTGASALQVQWSRERDPNWAAFLGTDVGELIACCHELGTTLKELSEW
LFDPIKQALRGAGSSPSTMAQFSNSGRRA

BLAST