GenomeNet

>cau:Caur_2554 K04037 light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7] | (RefSeq) chlL; protochlorophyllide reductase iron-sulfur ATP-binding protein (A)
MSLILAIYGKGGIGKSTTSANLSAAMALKGAKVLQIGCDPKHDSTFPLTGHLQPTVIDVL
DSVNFHLEDVSKEDVIRTGFAGVDTLESGGPPAGSGCGGYVVGETVKLLKEFGLYDKYDV
IVFDVLGDVVCGGFSAPLNYADYGLIIACNDFDSIFAANRLCLAISQKSQRHKVKLAGII
ANRVDYEYGGGTNLLDQFAEKVGTKVIGRVPYHDLIRRSRLAGKTLFEMEGPGKEECTRP
FEEMAEYLLAQPQATVPQPYHDRAIFEAIGGWR

BLAST