GenomeNet

>ccan:109683718 K09568 FK506-binding protein 1 [EC:5.2.1.8] | (RefSeq) Fkbp1b; peptidyl-prolyl cis-trans isomerase FKBP1B isoform X1 (A)
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE

BLAST