GenomeNet

>ccar:109097684 K20184 vacuolar protein sorting-associated protein 41 | (RefSeq) vacuolar protein sorting-associated protein 41 homolog (A)
MSPFLALGTHFGKVYLLDIQGNVTQKFEISPVKINQISLDESGDHVGICSEDGKVQVFGL
YTREGFHENFDCPIKVVALHPQFSKSNNKQFVTGGNKLLLYERNWLNRWKTSVLHEGEGN
ITNVKWRANLIAWANNVGVKIYDISSKQRITNVLRDNTNLRPDMYPCSLCWKDNTTLIIG
WGSSVKICVVKERDPTEMRDLPSRYVEIVSAFETEFFISGLAPLADQLVTLYYVKGQL

BLAST