GenomeNet

>cfa:100855947 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) TK1; thymidine kinase, cytosolic (A)
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSNSFSTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFSETMANAGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGSEKEVEVIGGADK
YHSVCRLCYFKKASGPPMGLDSRENKENVLVLVPGKPGEGKEATGVRKLFAPQHVLQCSP
AN

BLAST