GenomeNet

>cfa:610764 K04515 calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17] | (RefSeq) CAMK2D; calcium/calmodulin-dependent protein kinase type II subunit delta isoform X2 (A)
MASTATCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKKRKSSSSVQMMINNKANVVTSPKENIPTPALE
PQTTVIHNPDGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDP
GLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLT
QYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPSCIPNGKENFSGSTSL
WQNI

BLAST