GenomeNet

>cfd:CFNIH1_08090 K09988 D-lyxose ketol-isomerase [EC:5.3.1.15] | (GenBank) hypothetical protein (A)
MKRSAINEILGHTRQFFSLHDVHLPPFASFPPTQWRKLDASAWSEVFDLKLGWDVTAFGG
NNFAAQGLTLFTLRNGSPKGMPYEKCYAEKIMHVREAQVTPMHFHWRKREDIINRGGGNL
IVELWNAGLREQTEDSDVNVVIDGCRQTHAAGSQLRLTPGESICLPPGLYHSFWAEKGFG
DVLVGEVSSVNDDDHDNHFLHPITRYNDIEEDEPAQLVLCNEYRLFR

BLAST