GenomeNet

>cge:100750728 K03767 peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8] | (RefSeq) nuclear body protein SP140 isoform X1 (A)
MAEEDSRSSSWSTTEDEREEGSDDYRPKFKLFKENKVEIASAITKPFPFLMSLRDRGFLS
EQKFQISKKQCKNLDAVRNVVYDILCDLQKDFSLPLLEVIFSPTHLKAYPDLQETRKIFQ
DDTMETGNNTTLGKSQEKRDTVETRNNTTVGKSQEKTNYRGAGGQAAVRRRQRKSNPEGS
VRTVRRRARRLSRNEAVRFKAELLPVTCGRTKGVLHKDKFKLGLCRCRCPPSPVPAAMVN
PTVFFDITANGQPLGRVSFELFADKLPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQ
GGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD
GKHVVFGKVKEGMSTVEAMERFGSRTGKTSKKITISNCGQL

BLAST