GenomeNet

>cge:100772660 K08035 forkhead box protein A2, hepatocyte nuclear factor 3-beta | (RefSeq) Foxa2; hepatocyte nuclear factor 3-beta isoform X2 (A)
MHSASSMLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGG
SGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLG
GQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQ
SPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWT
LHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAGGVGGKKTAAGTQASQAQIGEAAGS
ASETPTGTESPHSSSSPCQEHKRGGLGELKGTPASALSPPEPAPSPGQQQQQAAAHLLGP
PHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYP
GGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

BLAST