GenomeNet

>cgi:CGB_E0450W K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] | (RefSeq) mitogen-activated protein (MAP) kinase (A)
MTIDQSQISFNVPSTYKLEEIVGEGAYGLVVAGTHLPSGTRVAIKRITPFDHTMFCQRTL
REVKLLRHFHHENIISILDLIQPESYEMFNEVYLVQELMETDLHRVIRSQELSDDHCQYF
VYQTLRGLKALHSADVLHRDLKPSNLLLNANCDLKICDFGLARSSAKPPPGTSDGGQGFM
TEYVATRWYRAPEVMLSFQEYTKAIDLWSVGCILAEMINGKPLFPGRDYHHQLSLILQVL
GTPTMDDFNEITSQRSKDYLRALEFTRRQDFSAICPKAMPAAVDLLKRTLTFSPSKRITV
EEALTHPYVEAYHDPQDEPNAEPLKPGFFDFEFHQEKLSRDQWKRMIYDEVQDPVPTILS
QWTANH

BLAST