GenomeNet

>cho:Chro.30248 K14565 nucleolar protein 58 | (RefSeq) snoRNA binding domain (A)
MLVLFETPAGYGLFRVTNSKLLSMDTDEIAEYFQNPDKVQKSVSLEAFLRFKDTKSALVE
ATALVESKLSKGLSKFIKKNIPNPASESLAVADKVLGGLIKQKYEIDVVYNPKMQEVMRG
IRNQLTDLLTGLTEKDMKTMALSLSHSLGRFKLKFSPEKIDTMIIQAVALLDDLDRELNN
YAMRLKEWYGWHFPELGKIISDRDVYANCIKVIGFRHCTRDANLQSPPCNIPSEMEAEIK
QAAEISMGTEITEEDLKNIIELCDRVLELSEYRESLSTYLKTRMSTIAPNLTYMVGELIG
ARLISHAGSLMNLAKHPSSTVQILGAEKALFRALKTKKSTPKYGLIYHAAVVGQSAPKLK
GKISRILAAKLSLCIRVDALNDQNEPTVAIENKQYVERRLEELSNQLTSGRLSSTGGNKK
PSTPSYSPVKSKALGSYDSSMDIVGSKRKPSGDSQEGSPDKRSKH

BLAST