GenomeNet

>cin:100180504 K02434 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7] | (RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial-like (A)
MMVNLIWNILCTRCMRVIANQKRHYVSEAKNIRVLHEQKWLPVIGLEVHAQINSRTKLFS
SALNKFMAPPNSLVSEFDASMPGTLPVLNKECVRAAVLTSLALNCKINPRSTFDRKHYFY
ADMPHGYQITQHWNPIAVDGKVTFPTLQGQKSLRIERVQLEQDSGKSLHDYEDNVSLIDL
NRAGVGLMEIVTFGLSNADDACAFVNELHLMLVTLGTCEGKMSEGQLRVDVNISLHKPGE
PLGTRAEVKNINGMRILHQVIEHEILRQSDLLDHGFAVEQETRGYDDVNRTTYSMRDKEM
KTDYRFMPEPNLPPLQLYDDLTIHNTCGDGINIDDIRREIPLLPAQLRKILDEKYKLDEQ
EIKFLLDREMVNYFIQVSELLPNTPPIEVYHWLKIKVVALLADNGLMMSQWPFNAKDFAD
LMSLKENNEINDSIAFEALTVAVKDKATTPVQVIENMGWKMISDITMISSLCDDVIIAME
TENPEVFEKYNVNNAKSNKKIVAKVVGKVFKASQGKMHTAIIKKTVQDLLNEKYNTNV

BLAST