GenomeNet

>cjc:100392399 K12800 NACHT, LRR and PYD domains-containing protein 3 | (RefSeq) NLRP3, CIAS1, cryopyrin; NLR family pyrin domain containing 3 (A)
MKMASTRCKLARYLEDLEDVDFKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWDNACASNHTVICQQDSIEEEWMGLLG
YLSRISICKKKKDYGKKYRRHVRSRFQCIEDRNARLGESVSLNKRYTPLRLIKEHRSQQE
REQELLTIGRTKAGDSPVSPIKMESLFEPDAEHAEPVHTVVFQGAAGIGKTILARKIMLD
WASGTLYQDRFDYLFYIHCRELSLVTQRSLGDLIMSCCPDPNPPIHRIVRKPSRILFLMD
GFDELQGAFDEHIGPLCTDWRKAERGDILLSSLIRKKLLPEAFLLITTRPVALEKLQHLL
DHPRHVEILGFSETKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCTGL
KQQMESGKSLAQTSKTTTAVYIFFLSSLLQPRGGSQEHTLSAHLWGLCSLAADGIWNQKI
LFEESDLRNHGLQKAEVSAFLRMNLFQKEVDCEKLYSFIHMTFQEFFAAMYYLLEEEKEG
GMQNVPGSCLTLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKVS
QQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDHFPKIEINLSTRM
DHVVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDVAQCVPPGSLTACSLGLVN
SHFTSSFCRGLFSVLSTNQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGL
SHECCLDLSLVLSSSQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSA
CCQDVASVLSTSHSLTRLYMGENTLGDAGVEILCEKAKNPQCHLQKLGLVNSGLTSACCS
ALSSVLSTNGNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDSCSLTSHCCWDLS
TLLTSSRSLRKLSLGNNDLGDLGVMMFCEVLRQQSCLLQNLGLCEMFFNYETKRALETLQ
EEKPELTIVFEPSW

BLAST