GenomeNet

>cjc:100407865 K12373 hexosaminidase [EC:3.2.1.52] | (RefSeq) HEXB; hexosaminidase subunit beta (A)
MELRGLGLLRLPMLLALLLATLLTAMLALLTQLALVAQAARAPGVLAQPRPALWPLPLSV
KMTPNLLRLAPENFYISHSPNSTAGPSCTLLEEAFRRYHDYIFGFYKLHHEPAEFQARTQ
LQQLLVSITLQSECDAFPSISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDS
YGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQS
FPYQSIAFPELSNKGSYSLSHIYTPNDVHMVIEYARLRGIRVLPEFDTPGHTLSWGKGQK
DLLTPCFNRKNKLDSFGPINPILHTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWES
NPKIQDFMRQKGFGTDFKQLESFYIQKLLDIIATIKKGSIVWQEVFDDKVKLEPGTIVEV
WKDSGYPQELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQEQKQLVIG
GEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRNMDDAYDRLTRHRCRMVKRGIAA
QPLFAGYCNHENM

BLAST