GenomeNet

>cjr:CJE0808 K06180 23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23] | (GenBank) RNA pseudouridylate synthase family protein (A)
MQEKAYKLLALQEKISNREAKDLIDKGCVFSHGKKVVVARALMSDKARFNVIKAKNPQII
FEDDKIIAINKPYAYVSEDLEKKFNAKLLNRLDKETSGVILLCKDEDFRKLCIEEFKKHR
VYKSYIAVLDGVLAEEVEVNEPIFTIKAKGGALSKVSKDGLSALSIITPIMMQSKKTLAK
IVIQTGRTHQIRVHAKFIKHGVVGDEKYAKISSDRMYLHSYEIKIFDYYFKAELDNSFAK
VGFEIKNLDF

BLAST