GenomeNet

>cmax:111479352 K13179 ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13] | (RefSeq) DEAD-box ATP-dependent RNA helicase 50 isoform X1 (A)
MARAPIHTPANFLTSRSLEPCYLRRYGCLRPPFLSQTLRPVPASKLVIVRGCVIAGYARK
SVDSDGFDQLTDDNDFTVYSSHELPYDGDVTVDNEDIKNSGTPRRISIGRLGRLKSQKVK
AIVMKGSRTKEEVKDDVRVLTSGNGSPHISDRPHSKVKTPGEKKKVNTLRNVERFSRSSE
LQDKGRHHRTPPSLSRSEQSVPAASATHFRGWGSRGPYDSEYESTQPKQQKFSSEKGFYS
RKSFKDLGCTEYMIESLRRQNFLRPSQIQAKAFASVIEGKSCIISDQSGSGKTLAYLAPL
IQRLRQEELQGLQKPSSQSPQIVIIVPTAELASQVLSNCRSISKFGVPFRSMVVTGGFRQ
KTQLDNLQEGVDVLIATPGRLMLLINEGFLQLSNLRCAVMDEVDILFNDEDFEVALQTLM
KSAPVNAQYLFVTATLPVDIYNTLVEKFPDCEVIMGPGVHRISPSLEEVLVDCSGEDEQN
KTPDAAFLNKKDALLQIAEGTPVLKTIVFCNKIETCRRVENALQRFDKKGSRLQVFPFHA
ALARDSRLANMEAFTNSHSNQVSKFLVCTDRASRGIDFPNVDHVILFDFPRDPSEYVRRV
GRTARGATGKGKAFIFVVGKQVSLARRIIERNRKGHPLHDVPSAYELTY

BLAST