GenomeNet

>cnb:CNBM0810 K13333 lysophospholipase [EC:3.1.1.5] | (RefSeq) hypothetical protein (A)
MSIITTAFALSLLATTAFAVPPETPRIELQAERGLGDQSYAPWQVDCPSNVTWIRNATTG
LGTGERAYIEAREKLVQPAIEQMMAARGLETPPRTPVIGVALAGGGYRAMLTGLGGIMGM
MNESTEASQSETGGWLDGVSYWSGLSGGSWATGSFMSNGGQLPTTLLENLWNIDSNLVFP
DDGKLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSHVLPEPYQLSNTPNLTFSSLPSV
VAALGNASLPMPIIVAADRKRREAGELVIAENATVWEFTPYEFGSWAFGSQYKSPGAFTP
IEYLGTSVDDGSPNGTCWKGFDQLSFVMGTSATLFNGAFLELNGTDSGLLTNLITAFLAD
LGEDQADISRIPNSFSNYNSGENPIYNLTYITLVDAGETNQNIPLEPLLVPTRDVDAIVA
FDSSYDSDYIWPNGTALRTTYERAKILAEHENTRVLMPEVPSMNGFVNGGYNSRPTFFGC
NDTTTPVIIYIPSYPWSFAANTSTYQLSYENNEANEMLLNGMRSLTLNHSVPTWPTCFAC
ALTDRSFMYTSENRSTTCQECFDTWCWAGDDNTTEPANYEPVINSVPPWLIANNLSIGMA
DAPGSNESTAGTASSGAAKMGVGMGMVALTAGLGLML

BLAST