GenomeNet

>cnc:CNE_1c27890 no KO assigned | (GenBank) hypothetical protein (A)
MTQVPVAVLAVFLVVGLRGAYAQTAPLVTPRVAQSQLMKSTDAALDERQARDWGLRPEEW
TRYRQLMQGPLGVYSPNLDPLTTLGIEARSDEERNHYAELQVQVEARRVNKTLAYQRAYD
AAWKRLYPGQQRVNLPGAQTLSAGNSGSGRLAVFVRADCAPCDQRVRQLQTAGTEFDVYM
VGSRLDDAYIRQWATRAGIDPARVRARTITLNHDAGRWLSLGVSGELPAVVRELNGRWQR
Q

BLAST