GenomeNet

>cox:E0W60_26560 K02890 large subunit ribosomal protein L22 | (GenBank) 50S ribosomal protein L22 (A)
MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEH
NEGADIDELKVKSIYVDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN

BLAST