GenomeNet

>cpe:CPE0583 K03306 inorganic phosphate transporter, PiT family | (GenBank) probable phosphate transport protein (A)
MSSTLAVTVVIILLTLAFDFINGFHDTATAVATSISTRALSPKAAIALCAVFNFVGAFLG
TEVAKTVGDGIVDQNKIPLWVIAAVILGAIIWNLITWYFGIPSSSSHALIGSLIGGGIAY
SHSINIVSWGTLFDEVILWLILSPIIGLIVGYIFMILLNWALRRCKPGPVNRIFSKLQVV
SGALMALNHGGNDAQKSMGIITMALLSGGFLSTFEVPTWVIALCAIAMATGTSIGGQKII
KTMGSGVAKLNAVNGFAAQTGAAGVIGIATMFHAPVSTTHIITTTIMGVGASKNPKAVKW
GVAKNIVWAWILTIPISACIAAIVVEIFKFVL

BLAST