GenomeNet

>cpic:101939630 K03252 translation initiation factor 3 subunit C | (RefSeq) EIF3CL; eukaryotic translation initiation factor 3 subunit C (A)
MKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYVRILADLEQYLNELWEDKEGKKKM
NKNNAKALSTLRQKIRKYNRDYESQISSYRQNPEQSADEDEERKSDDSEGSSSSEDDDDG
EGMSAAAFLKKKEPSGDSRSKFLKKMEVRALPGVRGGGGIAHVWQFPACPGGGATTLPLC
VPPEMWKKCLESIDELLDMLFANPNIFIGENILEESENLSNFEQPLRVRGCILTLVERMD
EEFTKIMQNTDPHSQEYVDHLKDEGRVCGIIGRVQSYLQEKGTTEEICRGYLRRVLHTYY
KFDYKAHQREQGPAGDSKILYNRTMVQGPGCVCGAWGGAVGAGRGAGWGQAVGRRGAVGG
RPWGGAGRLSPLSPQILYNRTMVQLGICAFRQGMTKDAHNALLDIQSSGRAKELLGQGLL
MRSLQERNQEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMIS
KQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHRFIINEKMNGKVWDLFPE
ADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMEILSDMFQLDLPTVHSIISKMIINEEL
MASLDQPTQTVVMHRTEPTALQNMALQLAEKLGNLVENNERVFDHKQGTYGGYFRDQKDG
YRKNEGGYMRRGGYRQQERQANY

BLAST