GenomeNet

>csab:103218635 K01942 biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15] | (RefSeq) HLCS; holocarboxylase synthetase (A)
MLITLCYLYLWARWGRRPAELVRATVRRLRASRCSFTFCGAAAQPPGARVCLSRGGRVFC
VSDSQSIEDLNKWALFLVSPFILEAEHIAFVTESIWVQSENLQRSSSSSETIVKWSDCCL
PLACRPGDPYRLIAEASVDNFSKLGVALMEDRLHMDNGLVPQKIMSVRLQDSTLKEVKDQ
ASNKQAQILEPKPEPSLEIKPEQDGMEHVGRDDPKALGEEPKQRRGSASGSEPAGDSDRG
GGPIEHYHLHLSSCHECLELENSTIESVKFASAENIPDLPYDYSSSLESVADETSPEREG
RRVNLTGKAPNILLYVGSDSQEALGRFHEVRSVLADCVDIDSYVLYHLLEDSALRDPWTD
NCLLLVIATRESIPEDLYQKFMAYLSQGGKVLGLSSSFTFGGFQVTNKGALRKTVQNLVF
SKADQSEVKLSVLSSGCRYQEGPVRLSPGGLQGHLENDDKDRMIVHVPFGTHGGEAVLCQ
VHLELPPSSDIVQTPEDFNLLKSSNFRRYEVLREILTTLGLSCDMKQVPALTPLYLLSAA
EEIRDPLMQWLGKHVDSEGEIKSSQLSLRFVSSYVSEVEITPSCIPVVTNMEAFSSENFN
LEIYRQNLQTKQLGKVILFAEVTPTTMRLLDGLMFQTPQEMGLIAIAARQTQGKGRGGNA
WLSPVGCALSTLLISIPLRSQLGQRIPFVQHLMSVAVVEAVRSIPKYQDINLRVKWPNDI
YYSDLMKIGGVLVNSTLMGETFHILIGCGFNVTNSNPTICINDLVTEYNKQHKAELKPLR
ADYLIARVVTVLEKLIEEFQDKGPNSVLPLYYRYWVHSGQQVHLGSTDGPKVSIVGLDDS
GFLQVHQEGGEVVTVHPDGNSFDMLRNLILPKRR

BLAST