GenomeNet

>csem:103394687 K16944 septin 7 | (RefSeq) septin-7 isoform X1 (A)
MAQQKNVEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEY
PGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQQVIDYIDSKFED
YLNAESRVNRRQMPDNRVHGCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTMT
PEECQQFKKQIIKEIQEHKIRIYEFPETDDEEETRIARKIKDCLPLAVVGSNTIIEVNGK
RVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMHDLKDVTNNVHYENYRSKNLAAVSCN
GVDNNRSKGQLTKPETTDGMSPLDQMEEERREHVAKMMKMEQEMEQVFEMKVKEKLQKLK
DSEMELQRRHEQMKKNLEALHKELEEKRRQQEEEKASWEAQQRILEQQKLEASRTLEKNK
KKKIF

BLAST