GenomeNet

>cvg:107089523 K12320 heat-stable enterotoxin receptor [EC:4.6.1.2] | (RefSeq) heat-stable enterotoxin receptor-like (A)
MSPCCWWLIVCTFWAFAALCRGNGQCGAGITINVILLEDEESPWSLKYVESEIEEAVLKD
NNINVAQGVGFNITADYEGFNTTFYTKRGCSSSICEAVEKLTKLMITGKLGCAVLGPTCT
FATFPLVDAEKGFNLSTPIISAGSFGRSCDSTLNLQRVLPPARKISDFFIKFWLENNSIK
PEWKTAYVYKKANNTEDCFWYINALEADGKFSAEVSRTMLRKPDEVKEILKTQENRTSNL
IIMCGSVQDLLELKNGSKAADSSDFLFMLIDLYNDVYYTNPSSLPEMKNVLVLTMPNTRE
YVINSDFRGNKTMNDYMAAYHDSVLYIGQVMREIFAKNQSDLHGMDYVNVNYFRNTSFKG
LAGNYKLDIKGDRDTNFSILYTTTSNEYKLLFTFDTEFNKTKVVDKNPAFVWGKKLPQYK
PNSRVAISDILVGVLTVTVVVVATIALIFYRQNRKDRLLRKRWCHINSDLISLLEDSQHN
IISLKIEDERKKVKFQIRRALYDKKIVILKELKNSDGNFNKTQTMELNALLNIDYYNLTK
FYGTVRFDEGVFGVFEYGERGSLRYVLNDKISYPEDTFMDWEFKISVMYDIAKGMSYLHA
STIQVHGRLKSTNCVVDNRMVVKITDFGCNAFLSSSKDLWTAPEHLRDQGTSQKGDVYSF
AIISQEIVLRKSTFYTQSCSNRSEKLSRVMTSYFRPDLDIEVASEKELEVYMMIKNCWDE
DPEKRPDFKKVENCLGKHISKIHNQDNESYMDNMIRRLQNYSRNLEHLVEKRTALYKAER
DRADFLNFMLLPGPVVKSLKETGVVEPELYDEVTIYFSDIVGFTTLCQYSTPMEVVDMLN
DIYKGFDSIVDNHDVYKTAGDRENVQRLQQDLAQMILSCLERRKQGSIRRKGRSVEEEED
EGRESEGDSEGGHPEYLQLATVDNTLSTFL

BLAST