GenomeNet

>cya:CYA_0359 K02434 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7] | (GenBank) gatB; glutamyl-tRNA(Gln) amidotransferase, B subunit (A)
MTVAAPAKVEYEAVIGLEVHCQLSTRSKIFSSSATAFGAPPNTQIDPVCMGLPGTLPVLN
EKVLEYAVKAGLALNCTIAPYSKFDRKQYFYPDLPKNYQISQYDLPIATHGWVEIQLSDG
RSKRIGITRLHIEEDAGKLVHAGSDRLSGSSYSLVDFNRAGVPLIEIVSEPDIRTGEEAA
EYVQELRRILRYAGLCDGNLQEGSLRCDVNISVRPLGSPTFGTKVEIKNMNSFNAIQRAI
EYEFNRQVKAVEAGEPIVQETRLWEENSQRTISMRKKEGSSDYRYFPEPDLPPIRVTEAQ
KARWQAELPELPSVKRRRYQQVYGLSVYDSRYLSDERNTAEYFEAVVAAGADPKAAANWM
MSDIASYLNTHKLDYPDIALKPETLAELIGLIEQGTISSKIAKEILPELLEKGGSARALV
EAKGLTQISDSSLLEPMIAEVLAENPEQLQQYREGKTKLFGYFVGQLMKKTQGRADPKLA
NELLKRHLDG

BLAST