GenomeNet

>cyt:cce_3700 K01990 ABC-2 type transport system ATP-binding protein | (GenBank) ATP-binding protein of ABC transporter (A)
MIVSELAIATFNLTKQFERHVAVNKLELEVQPGEVYGLIGPNGAGKTTLMRMLAAVEEPT
TGEIHIYGDRLLTDNSHPRLKQKLGYLPDDFPLYEDLNVWDYLDYFARLYHVKLPHRRRR
IQEVLELVQLTSKKDSNIKTLSRGMKQRLSLARTILHDPLLLLLDEPVSGLDPIARMQFR
EVIKILQSVGMTVLISSHVLSDLAELCTSVGIMELGSLVESTSLKDLYERLSHQQIIIKT
LGDLTQLQQELKGFSQVEEWEIISHQNSLRVNFSGGDEESAELLKYLIHRGIPIAEFHCT
QEDLESIFLKLDHKQAS

BLAST