GenomeNet

>daq:DAQ1742_01343 K00925 acetate kinase [EC:2.7.2.1] | (GenBank) ackA; Acetate kinase (A)
MSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKIDGGKQEAALGAG
AAHSEALSFIVNSIINQKPELSAQLVAIGHRIVHGGEKFTQSAIINDDVLQGIKDAIPFA
PLHNPAHLIGIEEALKEFPHLADKNVAVFDTAFHQTMPEEAYLYALPYKLYKDQHIRRYG
AHGTSHFYVSREAAKILGKSVDDLNVITCHLGNGGSVTAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAVVFHLHDAMGMSVADINKLLTKESGLLGLTEVTSDCRYVEDNYETKEDAK
RAMNVYCHRLAKYIGSYCALMEGRLDAVIFTGGIGENAAMVRELTLKQLGLMGLEIDHER
NLAARFGKGGNIAKDGSRPALVIPTNEELVIAQDALRLTA

BLAST