GenomeNet

>dcr:108197161 K03283 heat shock 70kDa protein 1/2/6/8 | (RefSeq) heat shock 70 kDa protein 18-like (A)
MAGRREGPAVGIDLGTMYSCVGVWQGSHVEIIANDHGSRTTPSCVAFSDTEILIGDAARN
QGGMNPDNTVFSVKRLIGRKFSDLSVQNDMKFWPFKVISNHGGKPMVLVTYKGQEKRFYA
EELSSMILIKMKEIVEKCLGSTVRNAVITVPAYFNDSQRNAIIDAGVISGINVIRVISEP
SAAAITYGLEKRKADSSTGGEKNVLVFDLGGSNCNVSLVVIEEGIFEVRATTGASHLGGE
DFVHRMVNHFIREIMRKNKKDITGNAKSIRRLKNACERAKRTLSSAAMTSIELEFLYDGV
SFSENISRDKFEELNMDLFKSCLELVEKCLRGGNIDKRNIHDVVLVGGSTRIPKVQQLLK
NFFNGKELCMSLNPDEAVANGAAVLAAILSGEGHEAVQDLMLLDVTPLSLGIGTSGETMS
VLIPKNTTIPTKREQIFSTSIDNQLDVLIEVFEGENPNTKDNNLLGKFVLSGISPAPKGV
PQFTVCFDIDAYGRLNVSAEDKTTGKKIKIKVTNNEERLSKEELEKMVKEAEKYRAEAKV
NKKATEKRMAGKGGPAIGLDLGTMYSCVGVWEGNHVEIIANDHGSRITPSCVAFSDTEVL
IGDAAYSQGGMNPNNTVFSVKRLIGRKFSDSKVLGDITFWPFKVISGPREKPVILVTYKG
QQKQFHVEEISSMILMKMKEIAENYLGSVVRDAVITVPAYFNDSQRNATVDAGVIAGLNV
MRIVAEPSAAAVAYGLEKKMAGSSTEGGKNVIIFDLGGSNCSVSLVVIEEGIFEVRATTG
ATHLGGEDFVNRMVSYFVKDFMRMYRKDISGNAKSVRRLRNACERAKRTLSSAAMTTIEL
EYLYDGADFSSNITRDRFEDLNMDLFNGCLELVEKCLTEASIDKRNIDDVVLVGGSTRIP
KVQQLLKHFFNGKELCLSMNPDEAVANGAAVLAAILSGEGNDTVQDLMLLDVTSLSLGIG
TSGETMSVMIPKNTTIPTKREQIFSTSIDNQLDVLIEVFEGENRNTKDNNLLGKFVLSGI
PPAPRGVPQFIVCFDIDAYGMLNVSAEDKTTGKKIKIKVTNNEERLSKEELEKMVKEAEK
FKAENSENKKAAEGRNALEDYIFKMKNVMSDEKFSSKLPFASRKKVENAMKLATQWLDRN
QTAKVEELEGIMKGLKGFAIA

BLAST