GenomeNet

>ddi:DDB_G0292814 no KO assigned | (RefSeq) symA; calmodulin-binding protein (A)
MPEILNSISTKTWLVVTQSCLGGLIFGYATGIIVGARGPIADKFGASIPLQGVIVCSILL
GALIGSFAGGFAADRFGRKPLLLFTAITTIAGAIGSGFGPNVATICILRFIHGLGVGSSS
SVCPLMVSEMVSEKRRGFFGSFFQISITVGILIANILAYAIAGEWKLMFCLGAIPGGLLF
IVWAFIAESPVYLEKQKKKLVRSTSGNEDLTTKGGDCDAASSGSVKKSGFSVIFAKNARK
PMLIGILLAVLAQLTGINAFMYFSTTIFLDAGIDGKNAPEIAAIILQVWNVLTTLIAISF
VDRLGRRFLLFTGSVVMTVCDLLIALFFVVLHGSAKGWASIVFLFIFVAGFEASIGTLFW
FVINEILPEESKSIGAPVINAFQWCFNLILSFFFLVVVEYLGQSTMFWIFGGIGLTTTIL
LYFNLPTSLGKTITSNPINNEVDTKNDSASPSSHNI

BLAST