GenomeNet

>dez:DKM44_11970 K02040 phosphate transport system substrate-binding protein | (GenBank) pstS; phosphate ABC transporter substrate-binding protein PstS (A)
MKKILNLGLGLMLLTVSAASAATITGAGSSFVYPLYTKMFAEYKKDHNVDVNYQSVGSGA
GQQQIIARTVDFGASDNPMSDEAMKPAPGKLLQIPTAIGAVVPAYNLPGVSTKLNFTGKL
LADIYLGKVKLWNDAAIKKLNPDVTLPGLPITVARRSDGSGTTAVFTDYLSKVSSEWKSK
VGSANSVQWPVGVGGKGNDGVAGIVKSTPGAIGYVELTYAKQNNLLFGAVQNRAGKFIVA
DNGPAANAAQGVVIPADTRVSITNSANPAAYPISSFTYVIFYQDQKYANRSQADAKELKD
LLNWMVTTGQQYNEPLDYAKLPSSVVNKAKALINSINYGGAKL

BLAST