GenomeNet

>dia:Dtpsy_1178 no KO assigned | (GenBank) putative secreted protein (A)
MKPSIILSALLLASTQLPAWAQQSATAPARNAQSQERPLVARILDDRVASDWGLQPQEWA
RYRELMDGPLGIYSPNLDPLSALGIEARTEEERRRYAELQVQVEARRVEKLLAYQRAYDE
AWQRLNPGMQRVNLPDDKPVAGATRGSGRTAVFVKDNCVACGQLVQRLQSSGAEFDLYMV
GSRQDDARIRDWAKRANVDPARVRSGSITLNHDGGRWLTLGVPGDLPAVVREVNGQWQRQ
P

BLAST