GenomeNet

>dlu:A6035_11440 K02890 large subunit ribosomal protein L22 | (GenBank) 50S ribosomal protein L22 (A)
MSTDTKKTADGTVESEQKLTARATAKFVRVTPMKARRVIDLIRGKDASDALDILRFAPQS
ASEPVAKVLASAMANAENNLDLDPRTLVVTTAYADEGPTLKRFRPRAQGRAFRVRKRTSH
ITVEVTSVPEKAGAGRGRRNQGGAR

BLAST