GenomeNet

>dme:Dmel_CG18361 K02353 segment polarity protein dishevelled | (RefSeq) dsh; dishevelled (A)
MDADRGGGQETKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDA
DFGVVKEEIADDSTILPCFNGRVVSWLVSADGTNQSDNCSELPTSECELGMGLTNRKLQQ
QQQQHQQQQQQQQQQHQQQQQQQQQQVQPVQLAQQQQQQVLHHQKMMGNPLLQPPPLTYQ
SASVLSSDLDSTSLFGTESELTLDRDMTDYSSVQRLQVRKKPQRRKKRAPSMSRTSSYSS
ITDSTMSLNIITVSINMEAVNFLGISIVGQSNRGGDGGIYVGSIMKGGAVALDGRIEPGD
MILQVNDVNFENMTNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPID
PGAWVAHTQALTSHDSIIADIAEPIKERLDQNNLEEIVKAMTKPDSGLEIRDRMWLKITI
PNAFIGADAVNWVLENVEDVQDRREARRIVSAMLRSNYIKHTVNKLTFSEQCYYVVNEER
NPNLLGRGHLHPHQLPHGHGGHALSHADTESITSDIGPLPNPPIYMPYSATYNPSHGYQP
IQYGIAERHISSGSSSSDVLTSKDISASQSDITSVIHQANQLTIAAHGSNKSSGSSNRGG
GGGGGGGGNNTNDQDVSVFNYVL

BLAST