GenomeNet

>dme:Dmel_CG7786 no KO assigned | (RefSeq) CG7786; uncharacterized protein (A)
MHSPAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSE
TLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDAKY
FERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLLGAT
TAGGMLSMARQV

BLAST