GenomeNet

>dmo:Dmoj_GI14172 K01887 arginyl-tRNA synthetase [EC:6.1.1.19] | (RefSeq) uncharacterized protein (A)
MLFDTDDNFKRRAYNRVVTLQNGTTESIKAWKLICDVSRKEFQKIYDRLDVTINERGESF
YQSRMVSVVEFLRNKGFLELDEGREIMWPDDSKSGIPLTIVKSDGGYTYDTSDMAAIRHR
IEEDHATWIIYVVDSGQSTHFNAIFKAAERCGILNPNVHRVDHVQFGVVLGDDGKKFKTR
SGDTVKLSDLLDEGMKYSLKQLQQRGRDKILTPKELLEAQEAVAYGCIKYTDLCHNRISD
YIFSFDKMLDDRGNTAVYLLYTYSRICSIARSSGKDFSNVEDILDKFNIELIHEKEWKLA
KTLLKLHDVLIKCANSLFLHFLCEFCYEVSVVFTEFYDSCYCIEKNEAGQIINVNHSRIL
ICEATAAVLRKCFHILGLKPVTKM

BLAST