GenomeNet

>dnv:108653569 K12818 ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13] | (RefSeq) ATP-dependent RNA helicase DHX8 isoform X1 (A)
MDELQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLEHKNRSYDAFRKALLENGAEFP
DSLVQNLQRIINLMRPSRPEYDAKITAGEDSKEDKKSQLKKMFPGLALPNDKFSCKMDED
EQNKEKESKQKLAINKNDMSDVDAAMLELEALEPGERKEESVKENSRSSRDRHKRKERSR
SRERDRDRNRDRDRKRESDRHREREKDNQRERERERDRERDKEHRRRRSRSREERDRDRD
RDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDHDRDHRKRRSSSRERQDRHEQRRRRSRS
RSPERSTRNQQQEKMPPPATGMSDDPEVGKIYSGKVANIVPFGCFVQLFGVRKRWEGLVH
ISQLRAEGRVTDVTEVVARNQTVKVKVMSLAGQKVSLSMKEVDQETGRDLNPLSHAPEED
ELTLRDRNPDGPYNSTSSMLNLQGNNIDGDEHESRKRVTRISSPERWEIKQMISSGVLDR
SEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQ
AAMMQSALSKERREQKMLQREQEMEAVPSNLNKNWIDPLPEDDSSRHLAANMRGMGAAPQ
EVPEWKKHVIGGKKSSFGKKTDLTLIEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSG
KTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTS
PETVIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKL
IVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPP
GDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSR
KVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGR
TGPGKCYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVES
LVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLS
VQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLK
RSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVV
YIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFK
KNQRLEPLYNKYEEPNAWRISRVRRRRN

BLAST