GenomeNet

>dosa:Os04t0446500-01 K14826 FK506-binding nuclear protein [EC:5.2.1.8] | (RAP-DB) Os04g0446500; Similar to OSIGBa0140O07.15 protein. (A)
MSSFWGAEVKPGKPYTHTHIPRLGRLRLTQATLGGEAGKVEKGGGGKKNVVQLQCTVKNK
DPVFLCALVPGQSETCHLELEFEEKHVTFSVLGPRSVHLAGYYIGDVYGEEIDDSDTGSD
SLQGSDDDAFLDTDDDDSGADDGTVLIPLSPGNSDGEDDDSEYDSEDDDSEMIYNQRRGK
SSVVIEEIQEDDKPAAGGAQKGSNKKQTSENGDDSKLQLVVRTPPAESLESEDEDGFPVS
FSESKKRTDGSSKKKGNLNNKMSTEDRKRKSSAVGDHHDPSGEVKDENDGVSKKNKKAKA
KKTAVGGVEKEIKQEDSPADLVDAKQKKNKNKNTSEAEAGAHQNTDKTKHIHTDAEEDTA
QEAS

BLAST