GenomeNet

>dpo:Dpse_GA26338 K14286 ethanolamine-phosphate phospho-lyase [EC:4.2.3.2] | (RefSeq) uncharacterized protein (A)
MPFAQEQSKSSTVASEQLSKTETIKLRNKHIGQACQLFYRSDPLKIVRGQGQYMFDEEGT
RYLDCINNVAHVGHCHPEVVRAGALQMATISTNNRFLHDELVQCAQTLTSKMPEPLSVCF
FVNSGSEANDLALRLARNFTKRQDVITLDHAYHGHLQAVMEVSPYKFNQPGGEKKPDYVH
VAPCPDTYGGQFTDKMYPNADLGALYAQPIEEICQRQLAKGQGVAAFIAESLQSCGGQIL
PPPGYFRAAYDAVRSSGGLCIADEVQVGFGRVGTHYWAFETQGVVPDIVCVAKPMGNGHP
VGAVVTTPEIAQAFHATGVAYFNTYGGNPVSCAIANAVMRVIDQEGLQQNALQLGDYLLR
ECSHLKQEFECIGDVRGVGLFVGIELVKDREGRIPDTKSARWVVNRMKQLHQVLVSSDGP
NDNVIKLKPPMCFSRENADEFLLAFRECLATLTQDKLATEAATAAATTTHGVIATAAETL
ANKTKLFERQDRLIKSV

BLAST