GenomeNet

>dpx:DAPPUDRAFT_301638 K03103 multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80] | (GenBank) hypothetical protein (A)
MSRHGTRNTGTKDMIKMKTELPLIFRNTKVNHKAGRGSLCDDDIKNLEDWEFLANVTEDK
FLVTEGFHELKGLGKRFQKRFPTLLSRPFVNESYVFQFTDSERTDVSAQAFAQGMFGRRD
SSNVYMKKSSKPDYLLRFYKTCDKWLKEVDENSTAIIEKKMYEKSPEFLGMIKSVSDRMG
FTSSLKLEEVDLMYSMCSFDKAWRPKDLSPWCAVFNEDDLQILEYREDLEYFYEDGYGYQ
INYEQACAPLKNIFENFRKTVSEESSVSQPKGFCYFTHSGTILKVLARIGLYKDKVRPTH
SNRLEQMNRAWRTSRIDSFASNIAFVLFKCADDYRVTAFIQERPVRLPGCSDDFCHFREF
VDQYGSLVSKCSIDDICRV

BLAST