GenomeNet

>dpx:DAPPUDRAFT_319725 K01769 guanylate cyclase, other [EC:4.6.1.2] | (GenBank) hypothetical protein (A)
MYGMLLESVQHFIQLEYGEETWLAILESVGYRNTVFRTHHIYPDELIMKLADAAVTLVAN
GSTRQDFLRFFGRCFVRYFSHYGYEKFIKVCGRYFCDFLTGIDNIHLQMRYMYPKMVSPS
MYISHEDAEGVLLHYRTTRNGFCPYLIGQLHQIAHDFYGIQLAVEELPKTPFNKEEGYQF
RFRLNFDNRDYMTGRSACNGSLELGRINISSRGSVSTTASEKALASLSSSILMQLFPFTL
VFRPDLQIIAVGRQLKQMFPDNALVGQALPDVARVRRPKLLFTWDNLYSLQKVLCEMELL
PAIRTARKNARHLAASKADSNAVANKEAKEENRRLMLQGQLRYLSDWNAMIFLCNPLINN
LEDMDGMGLTINDLSLHGHGRDMVMAGWQHNSRLEDMYERAEERSQQLQQTYELQDEWKK
RGDKLLYSMIPQSVADILRSGTDPVDTCQAFESITVLFVELANIDEITATNPMEAVSCMN
AVFSCFDNIIDQHNVYKVETVGKVYMVVGGAPETNETHVKDVAMGILQMVKDTKMSVHIR
IGFHTGSAVAGVVGKKMPRYCFFGDTINTAARMQTTSLPGKIHISQNSFCRLHNFNGFVF
EMRGTVFVKGKGDMKTHWLLRYQVPDGNST

BLAST