GenomeNet

>dto:TOL2_C04470 K00395 adenylylsulfate reductase, subunit B [EC:1.8.99.2] | (GenBank) aprB; AprB: adenylylsulfate reductase, beta subunit (A)
MPSFVIAEKCDGCKGGDKTACMYICPNDLMVLDPNEMKAYNQEPDQCWECFSCVKICPSQ
AIEVRGYSDFVPMGGSTVPMMGTEDVMWTCKFRNGVVKRFKFPIRTTPEGEANDYADLKG
KDLDSGLLSTQEADGYVLVAPTELA

BLAST