GenomeNet

>dze:Dd1591_0432 no KO assigned | (GenBank) protein of unknown function DUF1525 (A)
MINFAVLHMLASASIYSFSLHRLATVLLTALLSPLVQAADLLAVTDTRHPMQNLGNTRLI
ELDRPSRIEAELAANLPKDPTYATAIVQQRLKEGGTALQQRINEAYQNVVDAWSLGITTL
PAVIVDQRYVVYGEPDVAKAVARIEAYTRTQQ

BLAST