GenomeNet

>eas:Entas_1919 K11901 type VI secretion system protein ImpB | (GenBank) type VI secretion protein, VC_A0107 family (A)
MADSFQNEVPKARINLKLDLHTGGASKKTELPLKLLVAGDFSNGRESAPLSERKKVTLNK
NNFDAVLSDYSPDVNLTVKNTLADDGSEDNISLTFQSMKDFTPEQVSRQIPQLKAMLSMR
NLLRDLKANLLDNQAFRKELEKILLDPALSAELRSELSALAPKQP

BLAST