GenomeNet

>ebi:EbC_05830 K11901 type VI secretion system protein ImpB | (GenBank) conserved uncharacterized protein (A)
MATSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIELPFVMGVMSDLVGKSVEGLPAVDE
RKFLEIDIDNFDERMKALKPRVAFQADNTLTGEGRLNIDLTFNSMEDFSPDAVARNVEPL
NQLLDARTQLSNLLTYMDGKNGAEELISKILQDPTLLKSLSHLPKQDEAAKSGEE

BLAST